SCOPe 2.07: Domain d1vu3i_: 1vu3 I:

Lineage for d1vu3i_ (1vu3 I:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
   forms homo and heteroheptameric ring structures
   Pfam PF01423

6. Protein D1 core SNRNP protein [50184] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50185] (11 PDB entries)

8. Domain d1vu3i_: 1vu3 I: [240876]
   Other proteins in same PDB: d1vu3b_, d1vu3c_, d1vu3d_, d1vu3f_, d1vu3h_, d1vu3j_, d1vu3k_, d1vu3l_, d1vu3n_, d1vu3p_, d1vu3r_, d1vu3s_, d1vu3t_, d1vu3v_, d1vu3x_, d1vu3z_
   complexed with so4
   complexed with so4

Details for d1vu3i_

PDB Entry: 1vu3, 3.1 Å

PDB Description: The 8S snRNP Assembly Intermediate

PDB Compounds: (I:) Small nuclear ribonucleoprotein Sm D1

SCOPe Domain Sequences for d1vu3i_:

Sequence; same for both SEQRES and ATOM records:

>d1vu3i_ b.38.1.1 (I:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir
gnniryfilpdslpldtllvdv

Timeline for d1vu3i_:

• d1vu3i_ first appeared in SCOPe 2.04
  
• d1vu3i_ appears in SCOPe 2.06
  
• d1vu3i_ appears in the current release, SCOPe 2.08