Lineage for d1vsyr_ (1vsy R:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599542Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2599768Domain d1vsyr_: 1vsy R: [240801]
    Other proteins in same PDB: d1vsy1_, d1vsy2_, d1vsyb_, d1vsyf_, d1vsyg_, d1vsyh2, d1vsyi_, d1vsyj_, d1vsyk_, d1vsyl_, d1vsym_, d1vsyn_, d1vsyp_, d1vsyt_, d1vsyu_, d1vsyv2, d1vsyw_, d1vsyx_, d1vsyy_, d1vsyz_

Details for d1vsyr_

PDB Entry: 1vsy (more details), 3 Å

PDB Description: Proteasome Activator Complex
PDB Compounds: (R:) Proteasome component PRE6

SCOPe Domain Sequences for d1vsyr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsyr_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritpskvskidshvvlsfs
glnadsriliekarveaqshrltledpvtveyltryvagvqqrytqsggvrpfgvstlia
gfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrkeppatveecvkltv
rsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqeq

SCOPe Domain Coordinates for d1vsyr_:

Click to download the PDB-style file with coordinates for d1vsyr_.
(The format of our PDB-style files is described here.)

Timeline for d1vsyr_: