Lineage for d4nauc_ (4nau C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2469071Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2469072Protein automated matches [190459] (59 species)
    not a true protein
  7. 2469389Species Staphylococcus aureus [TaxId:196620] [237670] (3 PDB entries)
  8. 2469401Domain d4nauc_: 4nau C: [240618]
    automated match to d4naua_
    complexed with 2w3, ags

Details for d4nauc_

PDB Entry: 4nau (more details), 2.33 Å

PDB Description: s. aureus coad with inhibitor
PDB Compounds: (C:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d4nauc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nauc_ c.26.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 196620]}
mehtiavipgsfdpityghldiierstdrfdeihvcvlknskkegtfsleermdlieqsv
khlpnvkvhqfsgllvdyceqvgaktiirglravsdfeyelrltsmnkklnneietlymm
sstnysfisssivkevaayradisefvppyvekalkkkfk

SCOPe Domain Coordinates for d4nauc_:

Click to download the PDB-style file with coordinates for d4nauc_.
(The format of our PDB-style files is described here.)

Timeline for d4nauc_: