Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (78 species) not a true protein |
Species Pseudomonas mendocina [TaxId:399739] [234660] (1 PDB entry) |
Domain d4hn8f1: 4hn8 F:155-463 [240217] Other proteins in same PDB: d4hn8a1, d4hn8b1, d4hn8c1, d4hn8d1, d4hn8h1 automated match to d4hn8a2 complexed with gol |
PDB Entry: 4hn8 (more details), 2.2 Å
SCOPe Domain Sequences for d4hn8f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hn8f1 c.1.11.0 (F:155-463) automated matches {Pseudomonas mendocina [TaxId: 399739]} sgqqrqrvpmlaylfyigerqradlpylagkgsaddwyhlrhqaaltpdaiarlaeaara rygfadfklkggvmrgaeemeairaikarfpdarvtldpngawsldeaialckgqghvla yaedpcgpengysgrevmaefkratgiptatnmvatdwrqmghslrleavdipladphfw tmqgavrlgqvceefgltwgshsnnhfdislamfthaaaavpgritaidthwiwqegeer ltreplrivggqvqvpdkpglgiepdmqrimaahelykkvasgarddamamqylvpgwqy hpkrpslgr
Timeline for d4hn8f1: