Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (17 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries) |
Domain d4h32l_: 4h32 L: [240194] Other proteins in same PDB: d4h32a1, d4h32a2, d4h32c1, d4h32c2, d4h32e1, d4h32e2, d4h32g1, d4h32g2, d4h32i1, d4h32i2, d4h32k1, d4h32k2 automated match to d1rd8b_ complexed with nag |
PDB Entry: 4h32 (more details), 2.7 Å
SCOPe Domain Sequences for d4h32l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h32l_ h.3.1.1 (L:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} agfieggwqgmidgwygyhhenqegsgyaadkeatqkavdaitnkvnsiidkmnsqfesn ikefnrlelriqhlsdrvddalldiwsyntellvllenertldfhdanvknlfekvkaql kdnaidegngcflllhkcnnscmddikngtykymdyreeshiekqkidgve
Timeline for d4h32l_: