Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Pelagibaca bermudensis [TaxId:314265] [234600] (1 PDB entry) |
Domain d4h2hf1: 4h2h F:2-125 [240183] Other proteins in same PDB: d4h2ha2, d4h2ha3, d4h2hb2, d4h2hb3, d4h2hc2, d4h2hc3, d4h2hd2, d4h2hd3, d4h2he2, d4h2he3, d4h2hf2, d4h2hf3, d4h2hg2, d4h2hg3, d4h2hh2, d4h2hh3 automated match to d4h2ha1 complexed with 0xw, iod, mg, mpd, ni |
PDB Entry: 4h2h (more details), 1.7 Å
SCOPe Domain Sequences for d4h2hf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h2hf1 d.54.1.0 (F:2-125) automated matches {Pelagibaca bermudensis [TaxId: 314265]} kiaeiqlfqhdlpvvngpyriasgdvwsltttivkiiaedgtigwgetcpvgptyaeaha ggalaalevlasglagaealplplhtrmdsllcghnyaksaldiavhdlwgkrlgvpvhe llgg
Timeline for d4h2hf1: