SCOPe 2.07: Domain d4fgwb1: 4fgw B:33-234

Lineage for d4fgwb1 (4fgw B:33-234)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [232746] (5 PDB entries)

8. Domain d4fgwb1: 4fgw B:33-234 [240135]
   Other proteins in same PDB: d4fgwa2, d4fgwb2
   automated match to d4fgwa1

Details for d4fgwb1

PDB Entry: 4fgw, 2.45 Å

PDB Description: Structure of Glycerol-3-Phosphate Dehydrogenase, GPD1, from Sacharomyces Cerevisiae

PDB Compounds: (B:) Glycerol-3-phosphate dehydrogenase [NAD(+)] 1

SCOPe Domain Sequences for d4fgwb1:

Sequence; same for both SEQRES and ATOM records:

>d4fgwb1 c.2.1.0 (B:33-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kpfkvtvigsgnwgttiakvvaenckgypevfapivqmwvfeeeingeklteiintrhqn
vkylpgitlpdnlvanpdlidsvkdvdiivfniphqflpricsqlkghvdshvraisclk
gfevgakgvqllssyiteelgiqcgalsganiatevaqehwsettvayhipkdfrgegkd
vdhkvlkalfhrpyfhvsvied

Timeline for d4fgwb1:

• d4fgwb1 first appeared in SCOPe 2.04
  
• d4fgwb1 appears in SCOPe 2.06
  
• d4fgwb1 appears in the current release, SCOPe 2.08