Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (81 species) not a true protein |
Species Micrococcus luteus [TaxId:465515] [234402] (1 PDB entry) |
Domain d4ewpf1: 4ewp F:2-185 [240132] |
PDB Entry: 4ewp (more details), 2.2 Å
SCOPe Domain Sequences for d4ewpf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ewpf1 c.95.1.0 (F:2-185) automated matches {Micrococcus luteus [TaxId: 465515]} tvtlkqherpaasrivavgayrpanlvpnedligpidssdewirqrtgivtrqrataeet vpvmavgaarealeraglqgsdldavivstvtfphatpsaaalvaheigatpapaydvsa acagycygvaqadalvrsgtarhvlvvgverlsdvvdptdrsisfllgdgagavivaasd epgi
Timeline for d4ewpf1: