Lineage for d4edbf_ (4edb F:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645407Protein Influenza hemagglutinin (stalk) [58066] (17 species)
    trimer
  7. 2645520Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries)
  8. 2645817Domain d4edbf_: 4edb F: [240096]
    Other proteins in same PDB: d4edba_, d4edbc_, d4edbe_
    automated match to d4n5zb_

Details for d4edbf_

PDB Entry: 4edb (more details), 2.5 Å

PDB Description: structures of monomeric hemagglutinin and its complex with an fab fragment of a neutralizing antibody that binds to h1 subtype influenza viruses: molecular basis of infectivity of 2009 pandemic h1n1 influenza a viruses
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d4edbf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4edbf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
kvksqlknnakeigngcfefyhkcndecmesvkngtydyp

SCOPe Domain Coordinates for d4edbf_:

Click to download the PDB-style file with coordinates for d4edbf_.
(The format of our PDB-style files is described here.)

Timeline for d4edbf_: