Lineage for d4dxei_ (4dxe I:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487377Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1487378Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1487491Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 1487492Protein automated matches [191038] (14 species)
    not a true protein
  7. 1487521Species Staphylococcus aureus [TaxId:93062] [256240] (1 PDB entry)
  8. 1487524Domain d4dxei_: 4dxe I: [240082]
    Other proteins in same PDB: d4dxea_, d4dxeb_, d4dxec_, d4dxed_, d4dxee_, d4dxef_
    automated match to d3gzmb_
    complexed with mli

Details for d4dxei_

PDB Entry: 4dxe (more details), 2.51 Å

PDB Description: 2.52 angstrom resolution crystal structure of the acyl-carrier-protein synthase (acps)-acyl carrier protein (acp) protein-protein complex from staphylococcus aureus subsp. aureus col
PDB Compounds: (I:) Acyl carrier protein

SCOPe Domain Sequences for d4dxei_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dxei_ a.28.1.0 (I:) automated matches {Staphylococcus aureus [TaxId: 93062]}
namenfdkvkdiivdrlgvdadkvtedasfkddlgadsldiaelvmeledefgteipdee
aekintvgdavkfinsl

SCOPe Domain Coordinates for d4dxei_:

Click to download the PDB-style file with coordinates for d4dxei_.
(The format of our PDB-style files is described here.)

Timeline for d4dxei_: