Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein automated matches [190393] (9 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [255271] (5 PDB entries) |
Domain d4asuf2: 4asu F:82-357 [239992] Other proteins in same PDB: d4asua1, d4asua2, d4asua3, d4asub1, d4asub2, d4asub3, d4asuc1, d4asuc2, d4asuc3, d4asud1, d4asud3, d4asue1, d4asue3, d4asuf1, d4asuf3, d4asug_, d4asui_ automated match to d1mabb3 complexed with adp, mg |
PDB Entry: 4asu (more details), 2.6 Å
SCOPe Domain Sequences for d4asuf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4asuf2 c.37.1.11 (F:82-357) automated matches {Cow (Bos taurus) [TaxId: 9913]} iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa pattfahldattvlsraiaelgiypavdpldstsri
Timeline for d4asuf2: