Lineage for d4a63l1 (4a63 L:925-1055)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006504Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 3006505Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 3006506Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 3006604Protein automated matches [190101] (7 species)
    not a true protein
  7. 3006626Species Human (Homo sapiens) [TaxId:9606] [187689] (13 PDB entries)
  8. 3006649Domain d4a63l1: 4a63 L:925-1055 [239964]
    Other proteins in same PDB: d4a63a1, d4a63a2, d4a63b2, d4a63c1, d4a63c2, d4a63d2, d4a63e1, d4a63e2, d4a63f2, d4a63g1, d4a63g2, d4a63h2, d4a63i1, d4a63i2, d4a63j2, d4a63k1, d4a63k2, d4a63l2
    automated match to d4a63f1
    complexed with act, zn

    applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d4a63l1

PDB Entry: 4a63 (more details), 2.27 Å

PDB Description: crystal structure of the p73-aspp2 complex at 2.6a resolution
PDB Compounds: (L:) apoptosis stimulating of p53 protein 2

SCOPe Domain Sequences for d4a63l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a63l1 d.211.1.1 (L:925-1055) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nplallldsslegefdlvqriiyevddpslpndegitalhnavcaghteivkflvqfgvn
vnaadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkceemeegytqcs
qflygvqekmg

SCOPe Domain Coordinates for d4a63l1:

Click to download the PDB-style file with coordinates for d4a63l1.
(The format of our PDB-style files is described here.)

Timeline for d4a63l1: