Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (27 species) not a true protein |
Species Influenza a virus [TaxId:644788] [256161] (3 PDB entries) |
Domain d3znld_: 3znl D: [239957] Other proteins in same PDB: d3znla_, d3znlc_, d3znle_ automated match to d2fk0b1 complexed with epe, nag |
PDB Entry: 3znl (more details), 2.5 Å
SCOPe Domain Sequences for d3znld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3znld_ h.3.1.1 (D:) automated matches {Influenza a virus [TaxId: 644788]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqys
Timeline for d3znld_: