Lineage for d3znld_ (3znl D:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709416Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1709744Protein automated matches [254646] (27 species)
    not a true protein
  7. 1709892Species Influenza a virus [TaxId:644788] [256161] (3 PDB entries)
  8. 1709897Domain d3znld_: 3znl D: [239957]
    Other proteins in same PDB: d3znla_, d3znlc_, d3znle_
    automated match to d2fk0b1
    complexed with epe, nag

Details for d3znld_

PDB Entry: 3znl (more details), 2.5 Å

PDB Description: h5 haemagglutinin in complex with 6-o-sulfo-sialyl-lewis x (sulfated lewis x)
PDB Compounds: (D:) Haemagglutinin

SCOPe Domain Sequences for d3znld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3znld_ h.3.1.1 (D:) automated matches {Influenza a virus [TaxId: 644788]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqys

SCOPe Domain Coordinates for d3znld_:

Click to download the PDB-style file with coordinates for d3znld_.
(The format of our PDB-style files is described here.)

Timeline for d3znld_: