Lineage for d3tuig2 (3tui G:241-343)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560919Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2561134Family d.58.18.0: automated matches [227175] (1 protein)
    not a true family
  6. 2561135Protein automated matches [226892] (5 species)
    not a true protein
  7. 2561136Species Escherichia coli K-12 [TaxId:83333] [233744] (1 PDB entry)
  8. 2561139Domain d3tuig2: 3tui G:241-343 [239835]
    Other proteins in same PDB: d3tuia_, d3tuib_, d3tuic1, d3tuic3, d3tuid1, d3tuie_, d3tuif_, d3tuig1, d3tuih1, d3tuih3
    automated match to d3tuid2
    complexed with adp

Details for d3tuig2

PDB Entry: 3tui (more details), 2.9 Å

PDB Description: Inward facing conformations of the MetNI methionine ABC transporter: CY5 native crystal form
PDB Compounds: (G:) Methionine import ATP-binding protein metN

SCOPe Domain Sequences for d3tuig2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tuig2 d.58.18.0 (G:241-343) automated matches {Escherichia coli K-12 [TaxId: 83333]}
iqstlhldipedyqerlqaepftdcvpmlrleftgqsvdapllsetarrfnvnnniisaq
mdyaggvkfgimltemhgtqqdtqaaiawlqehhvkvevlgyv

SCOPe Domain Coordinates for d3tuig2:

Click to download the PDB-style file with coordinates for d3tuig2.
(The format of our PDB-style files is described here.)

Timeline for d3tuig2: