Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) regulatory domain linked to a wide range of metabolic enzymes |
Family d.58.18.0: automated matches [227175] (1 protein) not a true family |
Protein automated matches [226892] (5 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [233744] (1 PDB entry) |
Domain d3tuig2: 3tui G:241-343 [239835] Other proteins in same PDB: d3tuia_, d3tuib_, d3tuic1, d3tuic3, d3tuid1, d3tuie_, d3tuif_, d3tuig1, d3tuih1, d3tuih3 automated match to d3tuid2 complexed with adp |
PDB Entry: 3tui (more details), 2.9 Å
SCOPe Domain Sequences for d3tuig2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tuig2 d.58.18.0 (G:241-343) automated matches {Escherichia coli K-12 [TaxId: 83333]} iqstlhldipedyqerlqaepftdcvpmlrleftgqsvdapllsetarrfnvnnniisaq mdyaggvkfgimltemhgtqqdtqaaiawlqehhvkvevlgyv
Timeline for d3tuig2: