Lineage for d3spud1 (3spu D:43-270)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603630Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries)
  8. 2603797Domain d3spud1: 3spu D:43-270 [239731]
    Other proteins in same PDB: d3spua2, d3spuc2, d3spud2
    automated match to d3spua_
    complexed with zn

Details for d3spud1

PDB Entry: 3spu (more details), 2.1 Å

PDB Description: apo ndm-1 crystal structure
PDB Compounds: (D:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d3spud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3spud1 d.157.1.0 (D:43-270) automated matches {Klebsiella pneumoniae [TaxId: 573]}
dqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqil
nwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhslt
faangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlg
dadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d3spud1:

Click to download the PDB-style file with coordinates for d3spud1.
(The format of our PDB-style files is described here.)

Timeline for d3spud1: