Lineage for d1vlnf_ (1vln F:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164500Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 164501Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) (S)
  5. 164502Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 164506Protein Concanavalin A [49901] (2 species)
  7. 164512Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (42 PDB entries)
  8. 164559Domain d1vlnf_: 1vln F: [23968]

Details for d1vlnf_

PDB Entry: 1vln (more details), 2.4 Å

PDB Description: a triclinic crystal form of the lectin concanavalin a

SCOP Domain Sequences for d1vlnf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlnf_ b.29.1.1 (F:) Concanavalin A {Jack bean (Canavalia ensiformis)}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOP Domain Coordinates for d1vlnf_:

Click to download the PDB-style file with coordinates for d1vlnf_.
(The format of our PDB-style files is described here.)

Timeline for d1vlnf_: