Lineage for d3ldqa2 (3ldq A:189-381)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1606124Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1606125Protein automated matches [226839] (42 species)
    not a true protein
  7. 1606210Species Human (Homo sapiens) [TaxId:9606] [224896] (40 PDB entries)
  8. 1606226Domain d3ldqa2: 3ldq A:189-381 [239413]
    Other proteins in same PDB: d3ldqb_
    automated match to d3fzfa2
    complexed with 3p1

Details for d3ldqa2

PDB Entry: 3ldq (more details), 1.9 Å

PDB Description: Crystal structure of HSC70/BAG1 in complex with small molecule inhibitor
PDB Compounds: (A:) Heat shock cognate 71 kDa protein

SCOPe Domain Sequences for d3ldqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ldqa2 c.55.1.0 (A:189-381) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails

SCOPe Domain Coordinates for d3ldqa2:

Click to download the PDB-style file with coordinates for d3ldqa2.
(The format of our PDB-style files is described here.)

Timeline for d3ldqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ldqa1
View in 3D
Domains from other chains:
(mouse over for more information)
d3ldqb_