Class b: All beta proteins [48724] (178 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families) rudiment single hybrid fold with a permuted topology |
Family b.84.4.0: automated matches [254239] (1 protein) not a true family |
Protein automated matches [254547] (1 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [255254] (2 PDB entries) |
Domain d3l7zi1: 3l7z I:8-65 [239409] Other proteins in same PDB: d3l7za1, d3l7za2, d3l7zc2, d3l7zc3, d3l7zd1, d3l7zd2, d3l7zg1, d3l7zg2, d3l7zi2, d3l7zi3 automated match to d2je6i2 protein/RNA complex; complexed with so4 |
PDB Entry: 3l7z (more details), 2.41 Å
SCOPe Domain Sequences for d3l7zi1:
Sequence, based on SEQRES records: (download)
>d3l7zi1 b.84.4.0 (I:8-65) automated matches {Sulfolobus solfataricus [TaxId: 2287]} kivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdtqfevipleg
>d3l7zi1 b.84.4.0 (I:8-65) automated matches {Sulfolobus solfataricus [TaxId: 2287]} kivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdfevipleg
Timeline for d3l7zi1: