![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) ![]() |
![]() | Family f.23.11.0: automated matches [232790] (1 protein) not a true family |
![]() | Protein automated matches [232791] (3 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [232792] (8 PDB entries) |
![]() | Domain d3l74q2: 3l74 Q:196-241 [239393] Other proteins in same PDB: d3l74a1, d3l74a2, d3l74b1, d3l74b2, d3l74c1, d3l74c2, d3l74d1, d3l74e1, d3l74e2, d3l74f_, d3l74g_, d3l74h_, d3l74j_, d3l74n1, d3l74n2, d3l74o1, d3l74o2, d3l74p1, d3l74p2, d3l74q1, d3l74r1, d3l74r2, d3l74s_, d3l74t_, d3l74u_, d3l74w_ automated match to d3l70d2 complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq |
PDB Entry: 3l74 (more details), 2.76 Å
SCOPe Domain Sequences for d3l74q2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l74q2 f.23.11.0 (Q:196-241) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} pehdqrkrmglkmllisalltsllyymkrhkwsvlksrkmayrppk
Timeline for d3l74q2:
![]() Domains from other chains: (mouse over for more information) d3l74a1, d3l74a2, d3l74b1, d3l74b2, d3l74c1, d3l74c2, d3l74d1, d3l74d2, d3l74e1, d3l74e2, d3l74f_, d3l74g_, d3l74h_, d3l74j_, d3l74n1, d3l74n2, d3l74o1, d3l74o2, d3l74p1, d3l74p2, d3l74r1, d3l74r2, d3l74s_, d3l74t_, d3l74u_, d3l74w_ |