Lineage for d3krwa1 (3krw A:30-185)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332890Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2332891Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2332952Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 2332953Protein automated matches [190464] (3 species)
    not a true protein
  7. 2332962Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)
  8. 2332986Domain d3krwa1: 3krw A:30-185 [239365]
    Other proteins in same PDB: d3krwa2, d3krwa3, d3krwb_, d3krwg_
    automated match to d1omwa1
    complexed with ba1, mg

Details for d3krwa1

PDB Entry: 3krw (more details), 2.9 Å

PDB Description: Human GRK2 in complex with Gbetgamma subunits and balanol (soak)
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d3krwa1:

Sequence, based on SEQRES records: (download)

>d3krwa1 a.91.1.0 (A:30-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyeei
kkyekleteeervarsreifdsyimkellacshpfsksatehvqghlgkkqvppdlfqpy
ieeicqnlrgdvfqkfiesdkftrfcqwknvelnih

Sequence, based on observed residues (ATOM records): (download)

>d3krwa1 a.91.1.0 (A:30-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyeei
kkyekleteeervarsreifdsyimkellahpfsksatehvqghlgkkqvppdlfqpyie
eicqnlrgdvfqkfiesdkftrfcqwknvelnih

SCOPe Domain Coordinates for d3krwa1:

Click to download the PDB-style file with coordinates for d3krwa1.
(The format of our PDB-style files is described here.)

Timeline for d3krwa1: