Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) |
Family a.4.13.0: automated matches [254211] (1 protein) not a true family |
Protein automated matches [254475] (3 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [255804] (3 PDB entries) |
Domain d3dxjf2: 3dxj F:258-318 [239226] Other proteins in same PDB: d3dxjc_, d3dxjd_, d3dxje_, d3dxjf1, d3dxjm_, d3dxjn_, d3dxjo_, d3dxjp1 automated match to d1smyf1 protein/DNA complex; protein/RNA complex; complexed with mg, mpd, ne6, po4, zn |
PDB Entry: 3dxj (more details), 3 Å
SCOPe Domain Sequences for d3dxjf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dxjf2 a.4.13.0 (F:258-318) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl e
Timeline for d3dxjf2: