SCOPe 2.08: Domain d3c5rb1: 3c5r B:425-545

Lineage for d3c5rb1 (3c5r B:425-545)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein automated matches [190101] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187689] (13 PDB entries)

8. Domain d3c5rb1: 3c5r B:425-545 [239170]
   Other proteins in same PDB: d3c5ra3, d3c5rb2
   automated match to d3hg0d_
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d3c5rb1

PDB Entry: 3c5r, 2 Å

PDB Description: Crystal Structure of the BARD1 Ankyrin Repeat Domain and Its Functional Consequences

PDB Compounds: (B:) brca1-associated ring domain protein 1

SCOPe Domain Sequences for d3c5rb1:

Sequence; same for both SEQRES and ATOM records:

>d3c5rb1 d.211.1.1 (B:425-545) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nhrgetllhiasikgdipsveyllqngsdpnvkdhagwtplheacnhghlkvvelllqhk
alvnttgyqndsplhdaaknghvdivklllsygasrnavnifglrpvdytddesmkslll
l

Timeline for d3c5rb1:

• d3c5rb1 first appeared in SCOPe 2.04, called d3c5rb_
  
• d3c5rb1 appears in SCOPe 2.07