![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
![]() | Protein automated matches [226946] (29 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255011] (4 PDB entries) |
![]() | Domain d2zitc2: 2zit C:344-481 [239070] Other proteins in same PDB: d2zita1, d2zita3, d2zita4, d2zita5, d2zitb2, d2zitb3, d2zitc1, d2zitc3, d2zitc4, d2zitc5, d2zitd2, d2zitd3, d2zite1, d2zite3, d2zite4, d2zite5, d2zitf2, d2zitf3 automated match to d1n0ua1 protein/RNA complex; complexed with nad |
PDB Entry: 2zit (more details), 3 Å
SCOPe Domain Sequences for d2zitc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zitc2 b.43.3.0 (C:344-481) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl lktgtlttsetahnmkvm
Timeline for d2zitc2:
![]() Domains from same chain: (mouse over for more information) d2zitc1, d2zitc3, d2zitc4, d2zitc5 |