SCOPe 2.07: Domain d2zgub_: 2zgu B:

Lineage for d2zgub_ (2zgu B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (66 species)
   not a true protein

7. Species Agrocybe aegerita [TaxId:5400] [231694] (18 PDB entries)

8. Domain d2zgub_: 2zgu B: [239056]
   automated match to d2zgua_
   mutant

Details for d2zgub_

PDB Entry: 2zgu, 2.4 Å

PDB Description: crystal structure agrocybe aegerita lectin aal mutant i144g

PDB Compounds: (B:) Anti-tumor lectin

SCOPe Domain Sequences for d2zgub_:

Sequence, based on SEQRES records:

>d2zgub_ b.29.1.0 (B:) automated matches {Agrocybe aegerita [TaxId: 5400]}
mqgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllh
iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
viqytkqisgltsslsynateetsgfstvveavtytgla

Sequence, based on observed residues (ATOM records):

>d2zgub_ b.29.1.0 (B:) automated matches {Agrocybe aegerita [TaxId: 5400]}
mqgvniynisagtsvdlaapvttgdivtffssalnlnttlnlfaengayllhiafrlqen
viifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinektviqytkqi
sgltsslsynateetsgfstvveavtytgla

Timeline for d2zgub_:

• d2zgub_ first appeared in SCOPe 2.04
  
• d2zgub_ appears in SCOPe 2.06
  
• d2zgub_ appears in the current release, SCOPe 2.08