Class a: All alpha proteins [46456] (285 folds) |
Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily) core: 4 helices, bundle |
Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) contains 2Fe-2S cluster |
Family a.56.1.0: automated matches [227241] (1 protein) not a true family |
Protein automated matches [227007] (2 species) not a true protein |
Species Rhodobacter capsulatus [TaxId:1061] [255636] (2 PDB entries) |
Domain d2w3rg2: 2w3r G:85-166 [238909] Other proteins in same PDB: d2w3ra1, d2w3ra3, d2w3ra4, d2w3rb1, d2w3rb2, d2w3rc1, d2w3rc3, d2w3rc4, d2w3rd1, d2w3rd2, d2w3re1, d2w3re3, d2w3re4, d2w3rf1, d2w3rf2, d2w3rg1, d2w3rg3, d2w3rg4, d2w3rh1, d2w3rh2 automated match to d1jroa1 complexed with ca, fad, fes, hpa, mom, mpn |
PDB Entry: 2w3r (more details), 2.9 Å
SCOPe Domain Sequences for d2w3rg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w3rg2 a.56.1.0 (G:85-166) automated matches {Rhodobacter capsulatus [TaxId: 1061]} dgrlhpvqqamidhhgsqcgfctpgfivsmaaahdrdrkdyddllagnlcrctgyapilr aaeaaageppadwlqadaaftl
Timeline for d2w3rg2: