Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) |
Family d.145.1.0: automated matches [191624] (1 protein) not a true family |
Protein automated matches [191143] (12 species) not a true protein |
Species Rhodobacter capsulatus [TaxId:1061] [255637] (2 PDB entries) |
Domain d2w3re3: 2w3r E:179-345 [238906] Other proteins in same PDB: d2w3ra1, d2w3ra2, d2w3ra4, d2w3rb1, d2w3rb2, d2w3rc1, d2w3rc2, d2w3rc4, d2w3rd1, d2w3rd2, d2w3re1, d2w3re2, d2w3re4, d2w3rf1, d2w3rf2, d2w3rg1, d2w3rg2, d2w3rg4, d2w3rh1, d2w3rh2 automated match to d1jroa4 complexed with ca, fad, fes, hpa, mom, mte |
PDB Entry: 2w3r (more details), 2.9 Å
SCOPe Domain Sequences for d2w3re3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w3re3 d.145.1.0 (E:179-345) automated matches {Rhodobacter capsulatus [TaxId: 1061]} paflpetsdaladwylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretp dgygigagvtiaalrafaegphpalagllrrfaseqvrqvatiggniangspigdgppal iamgasltlrrgqerrrmpledffleyrkqdrrpgefvesvtlpksa
Timeline for d2w3re3: