Lineage for d2i5ja1 (2i5j A:1-429)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1692262Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1692263Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1692602Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 1692603Protein HIV-1 reverse transcriptase [56689] (3 species)
  7. 1692645Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (145 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 1692881Domain d2i5ja1: 2i5j A:1-429 [238681]
    Other proteins in same PDB: d2i5ja2
    automated match to d2ykna1
    protein/RNA complex; complexed with glc, k05, mg, suc

Details for d2i5ja1

PDB Entry: 2i5j (more details), 3.15 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase (rt) in complex with dhbnh, an rnase h inhibitor
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H P66 subunit

SCOPe Domain Sequences for d2i5ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i5ja1 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOPe Domain Coordinates for d2i5ja1:

Click to download the PDB-style file with coordinates for d2i5ja1.
(The format of our PDB-style files is described here.)

Timeline for d2i5ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i5ja2
View in 3D
Domains from other chains:
(mouse over for more information)
d2i5jb_