Lineage for d2ebdb2 (2ebd B:173-309)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1626713Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1626714Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1627417Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1627418Protein automated matches [196909] (45 species)
    not a true protein
  7. 1627432Species Aquifex aeolicus [TaxId:224324] [230695] (1 PDB entry)
  8. 1627436Domain d2ebdb2: 2ebd B:173-309 [238641]

Details for d2ebdb2

PDB Entry: 2ebd (more details), 2.1 Å

PDB Description: crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d2ebdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ebdb2 c.95.1.0 (B:173-309) automated matches {Aquifex aeolicus [TaxId: 224324]}
dilatrmyaegsleellhadncgyirmkgrelfkvavrsmeevcrevlekagvkpeevsl
viphqanvriinalaeklnipkekvfvniqkygntsaasipialheaikegkvkrgdlil
mtamgggltwgavllry

SCOPe Domain Coordinates for d2ebdb2:

Click to download the PDB-style file with coordinates for d2ebdb2.
(The format of our PDB-style files is described here.)

Timeline for d2ebdb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ebdb1