| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
| Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
| Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54711] (9 PDB entries) |
| Domain d2assa1: 2ass A:1002-1059 [238618] Other proteins in same PDB: d2assa2, d2assb1, d2assb2, d2assc_ automated match to d1fs1b2 complexed with ben, po4 missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 2ass (more details), 3 Å
SCOPe Domain Sequences for d2assa1:
Sequence, based on SEQRES records: (download)
>d2assa1 d.42.1.1 (A:1002-1059) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
asiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviqw
cthh
>d2assa1 d.42.1.1 (A:1002-1059) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
asiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthh
Timeline for d2assa1: