![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (28 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (776 PDB entries) |
![]() | Domain d1ynta1: 1ynt A:1-107 [238597] Other proteins in same PDB: d1ynta2, d1yntb1, d1yntb2, d1yntc2, d1yntd1, d1yntd2, d1ynte_, d1yntf1, d1yntf2, d1yntg1, d1yntg2 automated match to d2v7ha1 complexed with cd |
PDB Entry: 1ynt (more details), 3.1 Å
SCOPe Domain Sequences for d1ynta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ynta1 b.1.1.0 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} diqvtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps rfsgsgsgtdysltisnleqediatyfcqqgntlpytfgggtkleik
Timeline for d1ynta1: