| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (2 families) ![]() |
| Family c.55.6.0: automated matches [254201] (1 protein) not a true family |
| Protein automated matches [254441] (1 species) not a true protein |
| Species Escherichia coli [TaxId:562] [254938] (3 PDB entries) |
| Domain d1wbbb1: 1wbb B:117-269 [238590] Other proteins in same PDB: d1wbba1, d1wbba2, d1wbba4, d1wbbb2, d1wbbb3 automated match to d1wb9a3 protein/DNA complex; complexed with adp, mg; mutant |
PDB Entry: 1wbb (more details), 2.5 Å
SCOPe Domain Sequences for d1wbbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wbbb1 c.55.6.0 (B:117-269) automated matches {Escherichia coli [TaxId: 562]}
gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa
ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca
agcllqyakdtqrttlphirsitmereqdsiim
Timeline for d1wbbb1:
View in 3DDomains from other chains: (mouse over for more information) d1wbba1, d1wbba2, d1wbba3, d1wbba4 |