Lineage for d1bgyu_ (1bgy U:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005102Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3005103Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) (S)
    not a true superfamily
  5. 3005124Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (2 proteins)
    beta-hairpin and a short alpha-helix bound to the core subunits
  6. 3005145Protein automated matches [254424] (1 species)
    not a true protein
  7. 3005146Species Cow (Bos taurus) [TaxId:9913] [254879] (3 PDB entries)
  8. 3005150Domain d1bgyu_: 1bgy U: [238527]
    Other proteins in same PDB: d1bgya1, d1bgya2, d1bgyb1, d1bgyb2, d1bgyc2, d1bgyc3, d1bgyd2, d1bgyd3, d1bgye_, d1bgyf_, d1bgyg_, d1bgyh_, d1bgyj_, d1bgyk_, d1bgym1, d1bgym2, d1bgyn1, d1bgyn2, d1bgyo2, d1bgyo3, d1bgyp2, d1bgyp3, d1bgyq1, d1bgyq2, d1bgyr_, d1bgys_, d1bgyt_, d1bgyv_, d1bgyw_
    automated match to d2a06i_
    complexed with fes, hec, hem

Details for d1bgyu_

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine
PDB Compounds: (U:) cytochrome bc1 complex

SCOPe Domain Sequences for d1bgyu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyu_ d.184.1.3 (U:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
krsvlcreslrgqaagrplvasvslnvpasvry

SCOPe Domain Coordinates for d1bgyu_:

Click to download the PDB-style file with coordinates for d1bgyu_.
(The format of our PDB-style files is described here.)

Timeline for d1bgyu_: