SCOP 1.59: Domain d1qiub1: 1qiu B:396-582

Lineage for d1qiub1 (1qiu B:396-582)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.21: Virus attachment protein [49834] (1 superfamily)

4. Superfamily b.21.1: Virus attachment protein [49835] (2 families)

5. Family b.21.1.1: Adenovirus fiber protein head domain (knob domain) [49836] (1 protein)

6. Protein Adenovirus fiber protein head domain (knob domain) [49837] (4 species)

7. Species Human adenovirus type 2 [TaxId:10515] [49839] (2 PDB entries)

8. Domain d1qiub1: 1qiu B:396-582 [23844]
   Other proteins in same PDB: d1qiua2, d1qiub2, d1qiuc2, d1qiud2, d1qiue2, d1qiuf2

Details for d1qiub1

PDB Entry: 1qiu, 2.4 Å

PDB Description: a triple beta-spiral in the adenovirus fibre shaft reveals a new structural motif for biological fibres

SCOP Domain Sequences for d1qiub1:

Sequence; same for both SEQRES and ATOM records:

>d1qiub1 b.21.1.1 (B:396-582) Adenovirus fiber protein head domain (knob domain) {Human adenovirus type 2}
ddkltlwttpdpspncrihsdndckftlvltkcgsqvlatvaalavsgdlssmtgtvasv
siflrfdqngvlmensslkkhywnfrngnstnanpytnavgfmpnllaypktqsqtaknn
ivsqvylhgdktkpmiltitlngtsestetsevstysmsftwswesgkyttetfatnsyt
fsyiaqe

Timeline for d1qiub1:

• d1qiub1 first appeared (with stable ids) in SCOP 1.55
  
• d1qiub1 appears in SCOP 1.57
  
• d1qiub1 appears in SCOP 1.61
  
• d1qiub1 appears in the current release, SCOPe 2.08