SCOPe 2.07: Domain d4oj8b1: 4oj8 B:3-272

Lineage for d4oj8b1 (4oj8 B:3-272)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.8: gamma-Butyrobetaine hydroxylase [89416] (3 proteins)
   Pfam PF03322

6. Protein Carbapenem synthase, CarC [89417] (2 species)

7. Species Pectobacterium carotovorum [TaxId:555] [238281] (1 PDB entry)

8. Domain d4oj8b1: 4oj8 B:3-272 [238282]
   Other proteins in same PDB: d4oj8a2, d4oj8b2, d4oj8c2
   automated match to d1nx4c_
   complexed with 2tq, akg, fe2, gol

Details for d4oj8b1

PDB Entry: 4oj8, 2.1 Å

PDB Description: crystal structure of carbapenem synthase in complex with (3s,5s)- carbapenam

PDB Compounds: (B:) (5R)-carbapenem-3-carboxylate synthase

SCOPe Domain Sequences for d4oj8b1:

Sequence; same for both SEQRES and ATOM records:

>d4oj8b1 b.82.2.8 (B:3-272) Carbapenem synthase, CarC {Pectobacterium carotovorum [TaxId: 555]}
eivkfnpvmasgfgayidhrdfleaktetiknllmrqgfvvvknldidsdtfrdiysayg
tiveyadekigvgfgyrdtlklegekgkivtgrgqlpfhadgglllsqvdqvflyaaeik
nvkfrgattvcdhalacqempahllrvleeetfevrvlergyyvdvspdgwfkvpvftdl
gwvrkmliyfpfdegqpasweprivgftdhetqaffqelgaflkqpryyykhfwedgdll
imdnrrvihereefndddivrrlyrgqtad

Timeline for d4oj8b1:

• d4oj8b1 first appeared in SCOPe 2.03, called d4oj8b_
  
• d4oj8b1 was called d4oj8b_ in SCOPe 2.06
  
• d4oj8b1 appears in the current release, SCOPe 2.08