Lineage for d4edxw_ (4edx W:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2584898Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2584899Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2585103Family g.17.1.3: Neurotrophin [57520] (5 proteins)
    automatically mapped to Pfam PF00243
  6. 2585104Protein beta-Nerve growth factor [57525] (2 species)
  7. 2585105Species Human (Homo sapiens) [TaxId:9606] [57527] (5 PDB entries)
    Uniprot P01138
  8. 2585111Domain d4edxw_: 4edx W: [238122]
    Other proteins in same PDB: d4edxa1, d4edxa2, d4edxl1, d4edxl2
    automated match to d1wwww_

Details for d4edxw_

PDB Entry: 4edx (more details), 2.5 Å

PDB Description: Nerve Growth Factor in Complex with Fab from mouse mAb 911
PDB Compounds: (W:) Beta-nerve growth factor

SCOPe Domain Sequences for d4edxw_:

Sequence, based on SEQRES records: (download)

>d4edxw_ g.17.1.3 (W:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
gefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdpnpvdsgcr
gidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrka

Sequence, based on observed residues (ATOM records): (download)

>d4edxw_ g.17.1.3 (W:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
gefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdsgcrgidsk
hwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrka

SCOPe Domain Coordinates for d4edxw_:

Click to download the PDB-style file with coordinates for d4edxw_.
(The format of our PDB-style files is described here.)

Timeline for d4edxw_: