Lineage for d4p33b_ (4p33 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1366119Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1366120Protein automated matches [190123] (58 species)
    not a true protein
  7. 1366209Species Escherichia coli [TaxId:83333] [231728] (3 PDB entries)
  8. 1366212Domain d4p33b_: 4p33 B: [238068]
    automated match to d1ji0a_
    complexed with atp, gol, na

Details for d4p33b_

PDB Entry: 4p33 (more details), 1.65 Å

PDB Description: crystal structure of e. coli lptb-e163q in complex with atp-sodium
PDB Compounds: (B:) Lipopolysaccharide export system ATP-binding protein LptB

SCOPe Domain Sequences for d4p33b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p33b_ c.37.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
atltaknlakaykgrrvvedvsltvnsgeivgllgpngagktttfymvvgivprdagnii
iddddisllplhararrgigylpqeasifrrlsvydnlmavlqirddlsaeqredranel
meefhiehlrdsmgqslsggerrrveiaralaanpkfilldqpfagvdpisvidikriie
hlrdsglgvlitdhnvretlavcerayivsqghliahgtpteilqdehvkrvylg

SCOPe Domain Coordinates for d4p33b_:

Click to download the PDB-style file with coordinates for d4p33b_.
(The format of our PDB-style files is described here.)

Timeline for d4p33b_: