Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (2 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226565] (14 PDB entries) |
Domain d4o4lc2: 4o4l C:246-440 [238040] Other proteins in same PDB: d4o4la1, d4o4lb1, d4o4lc1, d4o4ld1, d4o4le_ automated match to d3ryha2 complexed with ca, ep, gdp, gtp, mes, mg, pou |
PDB Entry: 4o4l (more details), 2.2 Å
SCOPe Domain Sequences for d4o4lc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o4lc2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvdsv
Timeline for d4o4lc2: