SCOPe 2.03: Domain d4lcea2: 4lce A:126-318

Lineage for d4lcea2 (4lce A:126-318)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
   this domain interrupts the other domain which defines family

6. Protein Transcription corepressor CtbP [82298] (2 species)
   C-terminal binding protein 1; a dehydrogenase

7. Species Human (Homo sapiens), Ctbp1 [TaxId:9606] [82299] (2 PDB entries)

8. Domain d4lcea2: 4lce A:126-318 [237834]
   Other proteins in same PDB: d4lcea1
   automated match to d1mx3a1
   complexed with kmt, nad

Details for d4lcea2

PDB Entry: 4lce, 2.38 Å

PDB Description: ctbp1 in complex with substrate mtob

PDB Compounds: (A:) C-terminal-binding protein 1

SCOPe Domain Sequences for d4lcea2:

Sequence; same for both SEQRES and ATOM records:

>d4lcea2 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]}
eetadstlchilnlyrratwlhqalregtrvqsveqirevasgaarirgetlgiiglgrv
gqavalrakafgfnvlfydpylsdgveralglqrvstlqdllfhsdcvtlhcglnehnhh
lindftvkqmrqgaflvntargglvdekalaqalkegrirgaaldvhesepfsfsqgplk
dapnlictphaaw

Timeline for d4lcea2:

• d4lcea2 is new in SCOPe 2.03-stable
  
• d4lcea2 appears in SCOPe 2.04
  
• d4lcea2 appears in the current release, SCOPe 2.08