Lineage for d4bmeb_ (4bme B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2390546Species Human (Homo sapiens) [TaxId:9606] [187655] (107 PDB entries)
  8. 2390645Domain d4bmeb_: 4bme B: [237761]
    automated match to d1a3ka_
    complexed with lbt; mutant

Details for d4bmeb_

PDB Entry: 4bme (more details), 2 Å

PDB Description: crystal structure of the n terminal domain of human galectin 8, f19y mutant
PDB Compounds: (B:) Galectin-8

SCOPe Domain Sequences for d4bmeb_:

Sequence, based on SEQRES records: (download)

>d4bmeb_ b.29.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlqniiynpvipyvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradvafhf
nprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtlly
ghrigpekidtlgiygkvnihsigfsf

Sequence, based on observed residues (ATOM records): (download)

>d4bmeb_ b.29.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlqniiynpvipyvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradvafhf
nprfkragcivcntlinekwgreeitytpfkreksfeivimvlkdkfqvavngkhtllyg
hrigpekidtlgiygkvnihsigfsf

SCOPe Domain Coordinates for d4bmeb_:

Click to download the PDB-style file with coordinates for d4bmeb_.
(The format of our PDB-style files is described here.)

Timeline for d4bmeb_: