Lineage for d4iqca_ (4iqc A:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies)
core: beta(2)-alpha-beta(2); antiparallel beta-sheetSuperfamily d.26.1: FKBP-like [54534] (4 families) 
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) 
Protein Calcineurin (FKBP12.6) [54539] (3 species) Species Human (Homo sapiens) [TaxId:9606] [54540] (4 PDB entries) 
Domain d4iqca_: 4iqc A: [237570]
automated match to d4iq2a_
Details for d4iqca_
PDB Entry: 4iqc (more details), 1.9 Å
PDB Description: P3121 crystal form of FKBP12.6
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase fkbp1bSCOPe Domain Sequences for d4iqca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iqca_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Human (Homo sapiens) [TaxId: 9606]}
gveietispgdgrtfpkkgqtvvvhytgmlqngkkfdssrdrnkpfkfrigkqevikgfe
egaaqmslgqrakltitpdvaygatghpgvippnatlifdvellnle
SCOPe Domain Coordinates for d4iqca_:
Click to download the PDB-style file with coordinates for d4iqca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4iqca_:
- d4iqca_ first appeared in SCOPe 2.03
- d4iqca_ appears in SCOPe 2.06
- d4iqca_ appears in the current release, SCOPe 2.08
View in 3D
