Lineage for d4jzxa_ (4jzx A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1504321Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1504322Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1504597Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 1504598Protein automated matches [196409] (27 species)
    not a true protein
  7. 1504628Species Leishmania major [TaxId:5664] [236738] (3 PDB entries)
  8. 1504629Domain d4jzxa_: 4jzx A: [237281]
    automated match to d4jzba_
    complexed with 476, ca, ipe

Details for d4jzxa_

PDB Entry: 4jzx (more details), 1.8 Å

PDB Description: crystal structure of leshmaniasis major farnesyl diphosphate synthase in complex with 3-butyl-1-(2,2-diphosphonoethyl)pyridinium, ipp and ca2+
PDB Compounds: (A:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d4jzxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jzxa_ a.128.1.0 (A:) automated matches {Leishmania major [TaxId: 5664]}
mahmerfqkvyeevqefllgdaekrfemdvhrkgylksmmdttclggkynrglcvvdvae
amakdtqmdaaamervlhdacvcgwmiemlqahflveddimdhsktrrgkpcwylhpgvt
aqvaindglillawatqmalhyfadrpflaevlrvfhdvdltttigqlydvtsmvdsakl
dakvahanttdyveytpfnhrrivvyktayytywlplvmgllvsgtlekvdkkathkvam
vmgeyfqvqddvmdcftppeklgkigtdiedakcswlavtflttapaekvaefkanygst
dpaavavikqlyteqnllarfeeyekavvaeveqliaaleaqnaafaasvkvlwsktykr
qk

SCOPe Domain Coordinates for d4jzxa_:

Click to download the PDB-style file with coordinates for d4jzxa_.
(The format of our PDB-style files is described here.)

Timeline for d4jzxa_: