SCOP 1.63: Domain d1gof_2: 1gof 1-150

Lineage for d1gof_2 (1gof 1-150)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (15 families)

5. Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)

6. Protein Galactose oxidase, N-terminal domain [49787] (2 species)

7. Species Dactylium dendroides [TaxId:5132] [49788] (3 PDB entries)

8. Domain d1gof_2: 1gof 1-150 [23709]
   Other proteins in same PDB: d1gof_1, d1gof_3
   complexed with acy, cu, na

Details for d1gof_2

PDB Entry: 1gof, 1.7 Å

PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase

SCOP Domain Sequences for d1gof_2:

Sequence; same for both SEQRES and ATOM records:

>d1gof_2 b.18.1.1 (1-150) Galactose oxidase, N-terminal domain {Dactylium dendroides}
asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
aryvrlvaiteangqpwtsiaeinvfqass

Timeline for d1gof_2:

• d1gof_2 first appeared (with stable ids) in SCOP 1.55
  
• d1gof_2 appears in SCOP 1.61
  
• d1gof_2 appears in SCOP 1.65
  
• d1gof_2 appears in the current release, SCOPe 2.08, called d1gofa2