Lineage for d4n1gb_ (4n1g B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1489858Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1490393Protein automated matches [190064] (20 species)
    not a true protein
  7. 1490477Species Obelia longissima [TaxId:32570] [237068] (4 PDB entries)
  8. 1490480Domain d4n1gb_: 4n1g B: [237071]
    automated match to d1uhka_
    complexed with ca, cei; mutant

Details for d4n1gb_

PDB Entry: 4n1g (more details), 1.5 Å

PDB Description: Crystal Structure of Ca(2+)- discharged F88Y obelin mutant from Obelia longissima at 1.50 Angstrom resolution
PDB Compounds: (B:) obelin

SCOPe Domain Sequences for d4n1gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n1gb_ a.39.1.5 (B:) automated matches {Obelia longissima [TaxId: 32570]}
askyavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqt
krhqvcveaffrgcgmeygkeiafpqyldgwkqlatselkkwarneptlirewgdavfdi
fdkdgsgtitldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwyt
ldpeadglygngvp

SCOPe Domain Coordinates for d4n1gb_:

Click to download the PDB-style file with coordinates for d4n1gb_.
(The format of our PDB-style files is described here.)

Timeline for d4n1gb_: