SCOP 1.65: Domain d1ezsa_: 1ezs A:

Lineage for d1ezsa_ (1ezs A:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology with the crossing loops

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein)

6. Protein Ecotin, trypsin inhibitor [49774] (1 species)

7. Species Escherichia coli [TaxId:562] [49775] (13 PDB entries)

8. Domain d1ezsa_: 1ezs A: [23689]
   Other proteins in same PDB: d1ezsc_, d1ezsd_

Details for d1ezsa_

PDB Entry: 1ezs, 2.3 Å

PDB Description: crystal structure of ecotin mutant m84r, w67a, g68a, y69a, d70a bound to rat anionic trypsin ii

SCOP Domain Sequences for d1ezsa_:

Sequence, based on SEQRES records:

>d1ezsa_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli}
pypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegaaaay
yvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwk
aeekidnavvr

Sequence, based on observed residues (ATOM records):

>d1ezsa_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli}
pypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktayyvfdkv
sspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwkaeekid
navvr

Timeline for d1ezsa_:

• d1ezsa_ first appeared (with stable ids) in SCOP 1.55
  
• d1ezsa_ appears in SCOP 1.63
  
• d1ezsa_ appears in SCOP 1.67
  
• d1ezsa_ appears in the current release, SCOPe 2.08