Lineage for d4iraa_ (4ira A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1317892Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 1317893Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 1318081Family b.45.1.0: automated matches [191365] (1 protein)
    not a true family
  6. 1318082Protein automated matches [190439] (14 species)
    not a true protein
  7. 1318090Species Brucella melitensis [TaxId:224914] [236401] (1 PDB entry)
  8. 1318091Domain d4iraa_: 4ira A: [236402]
    automated match to d3cb0a_
    complexed with fad, so4

Details for d4iraa_

PDB Entry: 4ira (more details), 2.2 Å

PDB Description: CobR in complex with FAD
PDB Compounds: (A:) 4-hydroxyphenylacetate 3-monooxygenase

SCOPe Domain Sequences for d4iraa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iraa_ b.45.1.0 (A:) automated matches {Brucella melitensis [TaxId: 224914]}
stveskayrdamshyagavqivttagaagrrgltltaacsvsdnpptiliclqkiheenr
ifiengvfaintlagphqqladafsgrigltqderfelaaweilatgapvlkgalaafdc
rvvsvqdhsthhvlfgevvglsshaeeealiylnrryhklel

SCOPe Domain Coordinates for d4iraa_:

Click to download the PDB-style file with coordinates for d4iraa_.
(The format of our PDB-style files is described here.)

Timeline for d4iraa_: