SCOPe 2.03: Domain d4oenb_: 4oen B:

Lineage for d4oenb_ (4oen B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (57 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:637987] [193477] (5 PDB entries)

8. Domain d4oenb_: 4oen B: [236273]
   automated match to d1hsla_
   complexed with act, cl, so4

Details for d4oenb_

PDB Entry: 4oen, 1.65 Å

PDB Description: Crystal structure of the second substrate binding domain of a putative amino acid ABC transporter from Streptococcus pneumoniae Canada MDR_19A

PDB Compounds: (B:) Second substrate binding domain of putative amino acid ABC transporter

SCOPe Domain Sequences for d4oenb_:

Sequence; same for both SEQRES and ATOM records:

>d4oenb_ c.94.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 637987]}
kakyiiasdssfapfvfqnssnqytgidmelikaiakdqgfeieitnpgfdaaisavqag
qadgiiagmsvtdarkatfdfsesyytantilgvkessniasyedlkgktvgvkngtasq
tfltenqskygykiktfadgssmydslntgaidavmddepvlkysisqgqklktpisgtp
igetafavkkganpeliemfnnglanlkangefqkildkyla

Timeline for d4oenb_:

• d4oenb_ is new in SCOPe 2.03-stable
  
• d4oenb_ appears in SCOPe 2.04
  
• d4oenb_ appears in the current release, SCOPe 2.08