Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) |
Protein automated matches [190209] (7 species) not a true protein |
Species Human immunodeficiency virus 1 [TaxId:11676] [186963] (61 PDB entries) |
Domain d4ck3b_: 4ck3 B: [236119] automated match to d4ah9a_ complexed with act, k1t, so4 |
PDB Entry: 4ck3 (more details), 1.79 Å
SCOPe Domain Sequences for d4ck3b_:
Sequence, based on SEQRES records: (download)
>d4ck3b_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht dngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlkta vqmavfihnhkrkggiggysagerivdiiatdi
>d4ck3b_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht dngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlkta vqmavfihnhkrkgysagerivdiiatdi
Timeline for d4ck3b_: