Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) automatically mapped to Pfam PF00303 |
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) |
Protein automated matches [190469] (17 species) not a true protein |
Species Cryptosporidium hominis [TaxId:237895] [232024] (3 PDB entries) |
Domain d3hj3c2: 3hj3 C:192-521 [236019] Other proteins in same PDB: d3hj3a1, d3hj3b1, d3hj3c1, d3hj3d1 automated match to d3hj3a2 complexed with cb3, mtx, ndp, ump; mutant |
PDB Entry: 3hj3 (more details), 2.7 Å
SCOPe Domain Sequences for d3hj3c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hj3c2 d.117.1.1 (C:192-521) automated matches {Cryptosporidium hominis [TaxId: 237895]} qlksiddtvdllgeiagirkmgnrhkfpkeeiyntpsirfgrehyefqyldllsrvleng ayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfikgdtngnhliek kvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytgvgvdqlakl ietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyqrscdlglgs pfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtprpfpqlkfkr kveniedfkwedieligyypyptikmdmav
Timeline for d3hj3c2: