Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (37 species) not a true protein |
Species Toxoplasma gondii [TaxId:5811] [229953] (1 PDB entry) |
Domain d4nu7c_: 4nu7 C: [235825] automated match to d4nu7b_ complexed with cl, so4, zn |
PDB Entry: 4nu7 (more details), 2.05 Å
SCOPe Domain Sequences for d4nu7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nu7c_ c.1.2.0 (C:) automated matches {Toxoplasma gondii [TaxId: 5811]} qlkpiicpsvlasdlsslasdakrmvdagcdwlhldimdghfvpnisfgpgvvkalrghl ksaffdvhlmvsepekwiqpfadagansitfhwesvggdlqraaelakriqargikagla ikpatkfedlgealagdnfdmllvmtvepgfggqkfmadmlqkvrtarslfpklniqvdg gldgetvkpaasaganvivagtsmfkaenpaalmtfmrdviaasdtl
Timeline for d4nu7c_: