Class b: All beta proteins [48724] (119 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) sandwich; 8 strands in 2 sheets; jelly-roll variations: some members have additional 1-2 strands |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.4: Animal virus proteins [49656] (18 proteins) mammalian viruses |
Protein Coxsackievirus B3 [49680] (1 species) |
Species Host: human (Homo sapiens) [49681] (1 PDB entry) |
Domain d1cov2_: 1cov 2: [23565] |
PDB Entry: 1cov (more details), 3.5 Å
SCOP Domain Sequences for d1cov2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cov2_ b.10.1.4 (2:) Coxsackievirus B3 {Host: human (Homo sapiens)} gysdrvrsitlgnstittqecanvvvgygvwpdylkdseataedqptqpdvatcrfytld svqwqktspgwwwklpdalsnlglfgqnmqyhylgrtgytihvqcnaskfhqgcllvvcv peaemgcatlnntpssaellggdtakefadkpvasgsnklvqrvvynagmgvgvgnltif phqwinlrtnnsativmpytnsvpmdnmfrhnnvtlmvipfvpldycpgsttyvpitvti apmcaeynglrlaghq
Timeline for d1cov2_: